
от Уикипедия, свободната енциклопедия
Направо към навигацията Направо към търсенето

Оригинален файл(Файл във формат SVG, основен размер: 87 × 87 пиксела, големина на файла: 41 KB)

Емблемата на Общомедия Този файл е от Общомедия и може да се използва от други проекти.

Следва информация за файла, достъпна през оригиналната му описателна страница.


An icon for science stubs on :en.

Дата 2004-11-28; 2008-02-14
Източник en:Image:Science-symbol2.png
Автор en:User:AllyUnion, User:Stannered
(Повторно използване на файла)

The original image has been released into the public domain by its author, AllyUnion, at the English Wikipedia project. I, the creator of this derivative work, hereby release my modifications under the following licenses:

w:bg:Криейтив Комънс
признание на авторството
Този файл се разпространява под лиценза Криейтив Комънс Признание 3.0.
Можете свободно:
  • да споделяте – да копирате, разпространявате и излъчвате произведението
  • да ремиксирате – да адаптирате произведението
Съгласно следните условия:
  • признание на авторството – Трябва да посочите авторството, да добавите връзка към лиценза и да посочите дали са правени промени. Можете да направите това по всякакъв разумен начин, но не и по начин, оставящ впечатлението, че същият/същите подкрепят вас или използването по някакъв начин на творбата от вас.

GNU head Предоставя се разрешение за копиране, разпространение и/или модификация на този документ според Лиценза за свободна документация на ГНУ, в своята версия 1.2 или някоя следваща версия, издадена от Фондацията за свободен софтуер; без непроменими раздели, без текст на предната подвързия и без текст на задната подвързия. Копие на този лиценз е приложено в раздела Лиценз за свободна документация на ГНУ.
други версии

Derivative works of this file: Wikinews Ciência.png en:Image:Science-symbol2.png

Cafkfkcjdkckdkckdkcskckskfkdkckdkckdllapwpgodlcmdkfkdkckdkfkckgkdkfkdkdkskdifkfkfkgkdkfkfkfkdkfkfkslglqwefkckdkgkkgtegory:Created with Inkcnsncndkckdscape Caxmvkdkcktegory:Bohr model icons

История на файла

Избирането на дата/час ще покаже как е изглеждал файлът към онзи момент.

текуща21:08, 14 февруари 2008Миникартинка на версията към 21:08, 14 февруари 200887 × 87 (41 KB)Stannered{{Information |Description=An icon for science stubs on :en. |Source=en:Image:Science-symbol2.png |Date=2004-11-28; 2008-02-14 |Author=en:User:AllyUnion, User:Stannered |Permission=The original image has been released into the public domain

Следните 74 страници използват следния файл:

Глобално използване на файл