Кортикотропин-освобождаващ фактор

от Уикипедия, свободната енциклопедия
Направо към: навигация, търсене

Кортикотропин-освобождаващият фактор (CRH), известен още и като кортикотропин-освобождаващ хормон и кортиколиберин, е полипептиден хормон и невротрансмитер участващ в процеса на стрес и адаптация. Главната му финкция е да стимулира синтезата на адренокортикотропен хормон от хипофизата.

Кортикотропин-освобождаващият фактор (CRH) е пептид изграден от 41 аминокиселини, който се получава от препрохормон с големина от 191 аминокиселини чрез частична протеолиза. CRH се секретира в паравентрикулярното ядро (PVN) на хипоталамуса в отговор на състояние на биологичен стрес. Значителна редукция в производството на CRH се наблюдава при Болест на Алцхаймер и при автозомна рецисивна хипоталамична кортикотропна надостатъчност, които водят до множество потенциално фатални последствия като хипогликемия и хепатит. Освен в хипоталамуса известни количества CRH се синтезират и в периферните тъкани като Т-лимфоцити и особено от плацентата. Произхождащият от плацентата CRH е маркер определящ продължителността на бременността и времето на раждането. Наблюдава се бързо повишаване на нивата на циркулиращия CRH в началото раждането, което предполага, че освен основите си метаболитни функции, CRH играе роля в пусковия механизъм на раждането.[1]

Действие[редактиране | edit source]

CRH се произвежда от парвоклетъчните невроендокринни клетки (които се намират в паравентрикулярното ядро) на хипоталамуса и се освобождава в централното възвишение от невросекреторните аксони на невроните към първичния капилярен сплит на хипоталамо-хипофизната система. От там CRH се транспортира до аденохипофизата, където стимулира кортикотрофите да секретират адренокортикотропен хормон (ACTH) и други биологично активни субстанции като бета-ендорфин. ACTH стимулира синтезата на кортизол, глюкокортикоида, минералкортикоиди и дехидроепиандростерон.

α-спиралния участък на CRH (9–41 аминокиселина) действа като антагонист на CRH.[2]

Структура[редактиране | edit source]

Секвенцията на CRH от 41-аминокиселини е установена за пръв път при овца от Vale et al. през 1981г.[3] Аминокиселинната му последователност е:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA (за еднобуквените означения на аминокиселините виж Аминокиселина)

Човешкият пептид и този от плъх са идентични, като се различават само по 7 аминокиселини от овчия:[4]

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Взаимодействия[редактиране | edit source]

Кортикотропин-освобождавашият фактор е лиганд на рецептор известен като кортикотропин-освобождаваши фактор-рецептор-1, трансмембранен протеин член на семейството на G-протеин асоцийраните рецептори[5][6] , кодиран от CRHR1 гена.[7][8]

Роля при раждането[редактиране | edit source]

CRH се синтезира и от плацентата и изглежда определя продължителността на бременността.[9]

Нивата му се повишават в края на бременността непосредствено преди началото на подовия процес. По настоящем са приети три роли, които CRH изпълнява при раждането:[10]

  • Увеличава нивата на дехидроепиандростерона (DHEA) чрез директно влияние на феталните надбъбречни жлези и индиректно чрез майчината хипофиза. DHEA има роля в подготовката и стимулацията на цервикалните контракции.
  • Способства за увеличаване на достъпа на простагландин в утероплацентните тъкани. Простагландините активират цервикалните контракции.
  • Преди раждането потиска контракциите, чрез увеличаване на нивата на цАМФ в миометриума.


Фармакология[редактиране | edit source]

CRH-1 рецепторния антагонист pexacerfont се изследва за възможно лечение на състоянието на генерализирана тревожност при жените.[11] С друг антагонист antalarmin се експериментира върху животни като средство за лечение на безпокойство, депресия и други състояния.

Установени са, също тъка, ненормално високи нива на CRH в ликвора на жертви на самоубийство.[12]

Скорошни изследвания свързват активацията на CRH1 рецептора с чувството на еуфория съпровождащо консумацията на алкохол. Антагонистът на CRH1 рецептора, CP-154,526 (на Pfizer) се изследва като потенциално средство за лечение на алкохолизъм.[13][14]


Източници[редактиране | edit source]

  1. Entrez Gene: CRH corticotropin releasing hormone. //
  2. Santos J, Saunders PR, Hanssen NP, Yang PC, Yates D, Groot JA, Perdue MH. Corticotropin-releasing hormone mimics stress-induced colonic epithelial pathophysiology in the rat. // Am. J. Physiol. 277 (2 Pt 1). 1 August 1999. с. G391–9.
  3. Vale W, Spiess J, Rivier C, Rivier J. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin. // Science (journal) 213 (4514). September 1981. DOI:10.1126/science.6267699. с. 1394–7.
  4. Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL. NIH conference. Clinical applications of corticotropin-releasing factor.. // Annals of internal medicine 102 (3). March 1985. с. 344–358.
  5. Grammatopoulos, D K и др. A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes. // Mol. Endocrinol. 13 (12). UNITED STATES, Dec. 1999. DOI:10.1210/me.13.12.2189. с. 2189–202.
  6. Gottowik, J и др. Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin. // Neuropharmacology 36 (10). ENGLAND, Oct. 1997. DOI:10.1016/S0028-3908(97)00098-1. с. 1439–46.
  7. Polymeropoulos MH, Torres R, Yanovski JA, Chandrasekharappa SC, Ledbetter DH. The human corticotropin-releasing factor receptor (CRHR) gene maps to chromosome 17q12-q22. // Genomics 28 (1). July 1995. DOI:10.1006/geno.1995.1118. с. 123–4.
  8. Chen R, Lewis KA, Perrin MH, Vale WW. Expression cloning of a human corticotropin-releasing-factor receptor. // Proc. Natl. Acad. Sci. U.S.A. 90 (19). October 1993. DOI:10.1073/pnas.90.19.8967. с. 8967–71.
  9. Kimball JW. Hormones of the Hypothalamus. // Kimball's Biology Pages. 2006-06-15. Посетен на 2008-08-03.
  10. Lye S, Challis JRG. Chapter 12: Parturition. // Fetal growth and development. Cambridge, UK, Cambridge University Press, 2001. ISBN 0-521-64543-3. с. 241–266.
  11. Study of Pexacerfont (BMS-562086) in the Treatment of Outpatients With Generalized Anxiety Disorder. // ClinicalTrials.gov, 2008-08-01. Посетен на 2008-08-03.
  12. Arató M, Bánki CM, Bissette G, Nemeroff CB. Elevated CSF CRF in suicide victims. // Biol. Psychiatry 25 (3). 1989. DOI:10.1016/0006-3223(89)90183-2. с. 355–9.
  13. Drug Has Potential To Prevent Alcoholics From Relapsing. // Science News. ScienceDaily, 2008-08-02. Посетен на 2008-08-09.
  14. Pastor R, McKinnon CS, Scibelli AC, Burkhart-Kasch S, Reed C, Ryabinin AE, Coste SC, Stenzel-Poore MP, Phillips TJ. Corticotropin-releasing factor-1 receptor involvement in behavioral neuroadaptation to ethanol: a urocortin1-independent mechanism. // Proc. Natl. Acad. Sci. U.S.A. 105 (26). July 2008. DOI:10.1073/pnas.0710181105. с. 9070–5.